Query sequence: gi|24379936|ref|NP_721891.1| Accession: [none] Description: conserved hypothetical protein; possible integral membrane protein [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ABC2_membrane ABC-2 type transporter 18.4 7.3e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ABC2_membrane 1/1 2 210 .. 4 248 .] 18.4 7.3e-05 Alignments of top-scoring domains: ABC2_membrane: domain 1 of 1, from 2 to 210: score 18.4, E = 7.3e-05 *->kallkReflrrwRdpslgllwrliqpllmalvfGtvFgnlfkarlgV kallk e++ wR+++++ ++++ +p+ + l+++ + gi|2437993 2 KALLKVEWIKTWRTWPMF-IMAVGMPVGFFLIYSGMKM--------- 38 mindqtapqsgglgnrfgpsyidflvpGllffsllflafsslsgispvfi + +++g+ +df+ ++ ++++ ++ +++++ p + gi|2437993 39 --Y--D--TTQGQ--------TDFIRSFMITMTAFSMSSFGIFSF-PYML 73 rergv.....lEyrelasplYspsayvlakilvelpisllqaiifllivy +e +++ ++ ++ + +Y + ++l+++++s+++++++ ++v gi|2437993 74 KEDQTnhwlsY-LEHSRISIYKYYLSKIFRVLLNFLVSIIVTFMIGAFVR 122 f..mvGlrpsaadgrFngspgslflfllvllltalaasslglfiaalaps +m+++r+ + l+ll+ +l++++lgl+i +s gi|2437993 123 HveMTPIRW--------------IGTSLLLLMASLVFLALGLLIE-RIKS 157 fedasqigpllllplllfsGffiPldsmPpfewlqwiyylnPltYaieal ++++s++g++ +l l +++G P+ + p w q i+ ++P+++ + gi|2437993 158 EQIMSIVGNIAFLGLAILGGSWMPITMF-PD-WVQSISKVSPIYHVNQLA 205 ranef<-* + gi|2437993 206 VNFAQ 210