Query sequence: gi|24379895|ref|NP_721850.1| Accession: [none] Description: hypothetical protein SMU.1505c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- FDX-ACB Ferredoxin-fold anticodon binding domain 28.5 3.6e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- FDX-ACB 1/1 1 39 [] 59 97 .] 28.5 3.6e-07 Alignments of top-scoring domains: FDX-ACB: domain 1 of 1, from 1 to 39: score 28.5, E = 3.6e-07 *->lalrLvyRspeRTLtdeEvneaheklvaalkerfgveLR<-* +a++L++++p +LtdeEv + ek+ +al e+ g+e R gi|2437989 1 MAYSLTFQNPNDNLTDEEVAKYMEKITKALTEKIGAEVR 39