Query sequence: gi|24379877|ref|NP_721832.1| Accession: [none] Description: hypothetical protein SMU.1484c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ApoLp-III Apolipophorin-III precursor (apoLp-III) 13.4 0.00087 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ApoLp-III 1/1 402 431 .. 160 189 .] 13.4 0.00087 Alignments of top-scoring domains: ApoLp-III: domain 1 of 1, from 402 to 431: score 13.4, E = 0.00087 *->LaPkiKeAYddFvKqaeEvqKKlhEAAskq<-* L P+ + YddFvKq++E K +E +k gi|2437987 402 LIPQKSSSYDDFVKQIQESEKIFQETIQKL 431