Query sequence: gi|24379876|ref|NP_721831.1| Accession: [none] Description: hypothetical protein SMU.1483c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Acetyltransf_1 Acetyltransferase (GNAT) family 9.8 0.0091 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Acetyltransf_1 1/1 70 124 .. 25 80 .] 9.8 0.0091 Alignments of top-scoring domains: Acetyltransf_1: domain 1 of 1, from 70 to 124: score 9.8, E = 0.0091 *->eglaVdpeyRgkGiGtaLlealeeyareelGlkrieleveedNeaAi +g+ ++p+ R+kG+++ l+ ++ +a++ lG++++ ++ ++N ++ gi|2437987 70 IGYSIRPDERKKGYAKVQLRLALLEAKK-LGIDKVLVTCADWNIGSE 115 alYeklGFk<-* + + G + gi|2437987 116 RTILANGGV 124