Query sequence: gi|24379866|ref|NP_721821.1| Accession: [none] Description: hypothetical protein SMU.1471c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HTH_11 HTH domain 84.2 1.4e-22 1 HTH_DeoR DeoR-like helix-turn-helix domain 14.2 0.0027 1 Mga Mga helix-turn-helix domain 13.5 0.0033 1 Rrf2 Transcriptional regulator 10.6 0.0082 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Mga 1/1 1 42 [. 13 55 .. 13.5 0.0033 HTH_11 1/1 5 60 .. 1 62 [] 84.2 1.4e-22 HTH_DeoR 1/1 5 47 .. 1 43 [. 14.2 0.0027 Rrf2 1/1 19 61 .. 26 67 .. 10.6 0.0082 Alignments of top-scoring domains: Mga: domain 1 of 1, from 1 to 42: score 13.5, E = 0.0033 *->lkeSlklqlLkflfnfqeffsltelaqklfiSestlyRlikkl<-* ++eS +q++ +l+ +++++ la+++ +S+ t+yR i+ l gi|2437986 1 MRESRLFQIIYQLL-TKKKVTAANLAKQFEVSVRTIYRDIDAL 42 HTH_11: domain 1 of 1, from 5 to 60: score 84.2, E = 1.4e-22 *->RllqiLelLlqarepfvsgqeLAerLgVSRrTirrDIkaLealGeey Rl+qi+++Ll +++ v+++ LA++++VS rTi+rDI+aL+++G gi|2437986 5 RLFQIIYQLLTKKK--VTAANLAKQFEVSVRTIYRDIDALSSSG--- 46 GvpIesepgrgGGYr<-* +pI++ +g++GG++ gi|2437986 47 -IPIYASQGKNGGIQ 60 HTH_DeoR: domain 1 of 1, from 5 to 47: score 14.2, E = 0.0027 *->RieqIlelLkqqGtlsveeLvelldVSeaTiRRDLneLeeqGl<-* R+ qI+ L+ + +++ L+ ++ VS+ Ti RD++ L+ +G+ gi|2437986 5 RLFQIIYQLLTKKKVTAANLAKQFEVSVRTIYRDIDALSSSGI 47 Rrf2: domain 1 of 1, from 19 to 61: score 10.6, E = 0.0082 *->vtseeIAerqgispvyLrkilakLrkaGL.VkSvRGpgGGYrL<-* vt++ +A+ + +s + + + + L+ +G+++ + G++GG++L gi|2437986 19 VTAANLAKQFEVSVRTIYRDIDALSSSGIpIYASQGKNGGIQL 61