Query sequence: gi|24379781|ref|NP_721736.1| Accession: [none] Description: hypothetical protein SMU.1373c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Transposase_8 Transposase 17.7 0.00017 1 DUF746 Domain of Unknown Function (DUF746) 10.5 0.02 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF746 1/1 11 46 .. 1 36 [. 10.5 0.02 Transposase_8 1/1 11 50 .. 8 49 .. 17.7 0.00017 Alignments of top-scoring domains: DUF746: domain 1 of 1, from 11 to 46: score 10.5, E = 0.02 *->erlpalIRlLsqqislteaaerLGlDernianwvre<-* e+l+ +L +s+ + + G+D+ +i+ wvr+ gi|2437978 11 EKLEIVLLYLERERSISTLTRHSGVDHQTIKDWVRK 46 Transposase_8: domain 1 of 1, from 11 to 50: score 17.7, E = 0.00017 *->FKaqiValslepgaGasvsevArelGvspatLykWrkkyrgg<-* +K++iV l+le + +s+s + r+ Gv ++t+ W++ky+g+ gi|2437978 11 EKLEIVLLYLERE--RSISTLTRHSGVDHQTIKDWVRKYKGS 50