Query sequence: gi|24379748|ref|NP_721703.1|
Accession:      [none]
Description:    conserved hypothetical protein PksD, involved in polyketide synthesis [Streptococcus mutans UA159]

Scores for sequence family classification (score includes all domains):
Model         Description                               Score    E-value  N 
--------      -----------                               -----    ------- ---
Acyl_transf_1 Acyl transferase domain                    10.2      0.014   1

Parsed for domains:
Model         Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------      ------- ----- -----    ----- -----      -----  -------
Acyl_transf_1   1/1       4    49 ..     1    46 [.    10.2    0.014

Alignments of top-scoring domains:
Acyl_transf_1: domain 1 of 1, from 4 to 49: score 10.2, E = 0.014
                   *->VFVFsGQGaQWaGMGmqLlasspvFaaaiarcDeafqpqtGfsvld<
                      V++  GQG+Q+  MG++ ++ +  F+ +++ + + +++ + +svl+ 
  gi|2437974     4    VYLLNGQGSQYYHMGKSFYKKNLFFRNTLNNLNNKVKELFNISVLE  49   

                   -*
                     
  gi|2437974     -    -