Query sequence: gi|24379716|ref|NP_721671.1| Accession: [none] Description: hypothetical protein SMU.1300c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Cupin_2 Cupin domain 38.8 3.2e-11 1 MannoseP_isomer Mannose-6-phosphate isomerase 11.6 0.016 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Cupin_2 1/1 40 107 .. 1 74 [] 38.8 3.2e-11 MannoseP_isomer 1/1 63 95 .. 108 140 .. 11.6 0.016 Alignments of top-scoring domains: Cupin_2: domain 1 of 1, from 40 to 107: score 38.8, E = 3.2e-11 *->glvtlpPGgssppHrHpgedEffyVLeGeleltvdGefevvlkaGDs ++ l++ +++++H pg +++ +L+G +e+t+d+e ++++ aG+ gi|2437971 40 TIFSLDKDQEIGRHCSPGD-AMVNILSGLAEITIDEE-VFEVAAGQT 84 vyfpagvpHrfrNtgdeeparldlvvy<-* v+ pa++pH + + ++ + l v+ gi|2437971 85 VVMPANIPHSLYAKE---AFQM-LLVV 107 MannoseP_isomer: domain 1 of 1, from 63 to 95: score 11.6, E = 0.016 *->VVsGTAkVtvdeevflLtENEStYIPlGaiHrL<-* ++sG A++t+deevf + ++ + P+++ H+L gi|2437971 63 ILSGLAEITIDEEVFEVAAGQTVVMPANIPHSL 95