Query sequence: gi|24379707|ref|NP_721662.1| Accession: [none] Description: hypothetical protein SMU.1291c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CM_2 Chorismate mutase type II 92.2 5.4e-25 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CM_2 1/1 7 86 .. 1 81 [] 92.2 5.4e-25 Alignments of top-scoring domains: CM_2: domain 1 of 1, from 7 to 86: score 92.2, E = 5.4e-25 *->RkeIDriDrqIldLLaeRaelaqeigeiKkeqglpiydpeREaevLe R +ID +D+++++ L++R+ l+ +++ +Kk++g++++d +RE+ +Le gi|2437970 7 RSQIDDVDKELVQCLERRMTLVSQVADYKKATGKSVLDTKREQILLE 53 rlreeaeeggldpeyieaiFreIisasralQkpl<-* +++ ++ + + ++i aiF++I ++sr++Q+ gi|2437970 54 KVAGLVVNDTYR-STISAIFADILKHSRNYQRRA 86