Query sequence: gi|24379701|ref|NP_721656.1| Accession: [none] Description: hypothetical protein SMU.1284c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Saccharop_dh Saccharopine dehydrogenase 31.0 7.5e-08 1 NmrA NmrA-like family 10.7 0.0052 1 DapB_N Dihydrodipicolinate reductase, N-terminu 8.9 0.014 1 Epimerase NAD dependent epimerase/dehydratase fami 10.6 0.019 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DapB_N 1/1 2 33 .. 1 32 [. 8.9 0.014 Epimerase 1/1 4 73 .. 1 87 [. 10.6 0.019 NmrA 1/1 4 21 .. 1 18 [. 10.7 0.0052 Saccharop_dh 1/1 4 76 .. 1 85 [. 31.0 7.5e-08 Alignments of top-scoring domains: DapB_N: domain 1 of 1, from 2 to 33: score 8.9, E = 0.014 *->ikvaVaGAsGRMGrelikavleapdleLvaav<-* +v V GA+GR G +ik++ + + +L a++ gi|2437970 2 KRVLVLGATGRTGNFVIKELSKYKSIQLIAGL 33 Epimerase: domain 1 of 1, from 4 to 73: score 10.6, E = 0.019 *->iLVTGgtGfiGsaLvrrLleeGye.vivlDalgrrrrseslgtgrit +LV+G+tG G ++++L + + i a r ++++ ++ i+ gi|2437970 4 VLVLGATGRTGNFVIKELSKYKSIqLI---AGLRSQKDKERLPK-IN 46 hlyqidphesktprvefvygDltdpdalerllaeaqPDaVi<-* + +e v D+ d +l+++l ++ D V+ gi|2437970 47 ------------AAIETVVIDIADVCSLRKALTDS--DIVV 73 NmrA: domain 1 of 1, from 4 to 21: score 10.7, E = 0.0052 *->IlVfGATGyQGgsVvras<-* +lV GATG+ G++V++ + gi|2437970 4 VLVLGATGRTGNFVIKEL 21 Saccharop_dh: domain 1 of 1, from 4 to 76: score 31.0, E = 7.5e-08 *->VLilGA.GgvGrvvaekLaqrndggleitvAsRtlekaqalaasiaa VL+lGA+G++G +v+ +L++ + ++ + + R+ + ++l + gi|2437970 4 VLVLGAtGRTGNFVIKELSK--YKSIQLIAGLRSQKDKERLPK---- 44 lslpkggprveaisvDasdveaLaalikgtkaDlVinaa<-* ++ +e+++ D++dv +L++++ + +D+V+ a+ gi|2437970 45 -----INAAIETVVIDIADVCSLRKALTD--SDIVVQAI 76