Query sequence: gi|24379674|ref|NP_721629.1| Accession: [none] Description: hypothetical protein SMU.1253c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Acetyltransf_1 Acetyltransferase (GNAT) family 44.8 1.9e-14 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Acetyltransf_1 1/1 43 119 .. 1 80 [] 44.8 1.9e-14 Alignments of top-scoring domains: Acetyltransf_1: domain 1 of 1, from 43 to 119: score 44.8, E = 1.9e-14 *->lvaeedgelvGfaglspidevaeieglaVdpeyRgkGiGtaLleale +v ++ ++++ a++ ++++ ie laVd ++++ +G++Ll+++ gi|2437967 43 VVKDDAARILAAASCQQLYQTLKIENLAVDSVFQKQKFGSQLLDYIK 89 eyareelGlkrieleveedNeaAialYeklGFk<-* +yar+ +++ +++l +++ ++ +Y k+GF+ gi|2437967 90 DYARA-HNILTLTLSTRSYQA--KDFYLKQGFH 119