Query sequence: gi|24379634|ref|NP_721589.1| Accession: [none] Description: hypothetical protein SMU.1209c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF23 Domain of unknown function 8.1 0.049 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF23 1/1 58 95 .. 303 340 .] 8.1 0.049 Alignments of top-scoring domains: DUF23: domain 1 of 1, from 58 to 95: score 8.1, E = 0.049 *->dlermrnsqkitklflelpkedfystiidkcynesfyl<-* d+e++++++k ++f el k+++ ++ ++ y+e +++ gi|2437963 58 DFENIMSFWKENHIFEELLKIRYSLNSDFNSYDELKKH 95