Query sequence: gi|24379625|ref|NP_721580.1| Accession: [none] Description: hypothetical protein SMU.1197 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DedA DedA family 8.4 0.057 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DedA 1/1 71 117 .. 26 72 .. 8.4 0.057 Alignments of top-scoring domains: DedA: domain 1 of 1, from 71 to 117: score 8.4, E = 0.057 *->FllipfGviaglgitklgflagilpgliggllGdavsywlgrrfgnk F+ ip+Gv+ +g + +g+++g+++ ig ++G++++++l +++g+k gi|2437962 71 FPVIPGGVTTVAGFLIFGTWLGFILNYIGIIIGSVLLFLLVKWLGRK 117 <-* gi|2437962 - -