Query sequence: gi|24379582|ref|NP_721537.1| Accession: [none] Description: hypothetical protein SMU.1151c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF438 Family of unknown function (DUF438) 173.7 1.9e-63 1 Hemerythrin Hemerythrin HHE cation binding domain 46.9 4.4e-12 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF438 1/1 4 89 .. 1 87 [] 173.7 1.9e-63 Hemerythrin 1/2 90 155 .. 1 69 [] 22.8 1.8e-05 Hemerythrin 2/2 164 222 .. 1 69 [] 24.2 7.3e-06 Alignments of top-scoring domains: DUF438: domain 1 of 1, from 4 to 89: score 173.7, E = 1.9e-63 *->eeRkelLKEvLkeLHkGgsvEelkkrFkdvfkgIspiEIsliEQeLi +eR+e+LK++L+eLH+G+s E++++rF+++fkg+s+iEIs++E+eL+ gi|2437958 4 DERIEVLKDILLELHHGASAESVQERFNQHFKGVSAIEISMMEHELM 50 kEd.GinpediqkLCDvHaelFKgaiedvkksetEklPeGH<-* + d+Gi++ed++ LC+vHa+lFKgai dv+++++E+ eGH gi|2437958 51 NADtGITFEDVMGLCNVHANLFKGAIADVDVPDAEQ--EGH 89 Hemerythrin: domain 1 of 2, from 90 to 155: score 22.8, E = 1.8e-05 *->pidelkaeHkelralleellelledgeldh.ag.edkleadesldel p++++k+e+ +lra++ ++++ +e+++++ + + +e+l+ l gi|2437958 90 PVKVFKDENLALRAAIMRIRRIIENYTKPEnEDfR-----QEILKGL 131 aelleelidwleHikkEEeilfpl<-* +++++ l +++ H++++E+++fp gi|2437958 132 KHQFDLLGQFYHHYTRKEKLFFPI 155 Hemerythrin: domain 2 of 2, from 164 to 222: score 24.2, E = 7.3e-06 *->pidelkaeHkelralleellelledgeldhagedkleadesldelae p ++++ +++r+l+++ +++l++++ d s++el + gi|2437958 164 PPKVMWGVDDDIRDLFKDAKATLAKLP-----------DGSIEELSQ 199 lleelidwle.HikkEEeilfpl<-* +e++ + +e++i+kEE+il gi|2437958 200 KFEAFAKEFEeMIFKEEAILLMI 222