Query sequence: gi|24379507|ref|NP_721462.1| Accession: [none] Description: hypothetical protein SMU.1070c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- LytTR LytTr DNA-binding domain 92.7 5.1e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- LytTR 1/1 71 168 .. 1 100 [] 92.7 5.1e-27 Alignments of top-scoring domains: LytTR: domain 1 of 1, from 71 to 168: score 92.7, E = 5.1e-27 *->grlfllplddIlyiETeaedhyvrivtadgeylvrgtLkdlekkLpp ++ +l+lddIly+ e d+ v ++t++++y++ +L+dle+ +++ gi|2437950 71 KGNTFLWLDDILYC--ERVDGLVFAYTKNKVYQIFHSLRDLEASYYR 115 pnFlRvHRSylVNlnkIreidkdfsGrleltlkngeklpvSRrylkelke + +R+++S +VN+ kI+ +++ + Gr ++t++n+e++ +SR+y+ +++ gi|2437950 116 LGYVRCSKSMIVNIYKIHYFNSEPYGRIRATMENKEEIIISRKYANRIRT 165 llk<-* +l+ gi|2437950 166 ILQ 168