Query sequence: gi|24379468|ref|NP_721423.1|
Accession:      [none]
Description:    hypothetical protein SMU.1029 [Streptococcus mutans UA159]

Scores for sequence family classification (score includes all domains):
Model        Description                                Score    E-value  N 
--------     -----------                                -----    ------- ---
Sigma70_r4_2 Sigma-70, region 4                          20.5    3.7e-05   1
Sigma70_r4   Sigma-70, region 4                          11.3      0.024   1

Parsed for domains:
Model        Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------     ------- ----- -----    ----- -----      -----  -------
Sigma70_r4_2   1/1      78   113 ..     1    36 [.    20.5  3.7e-05
Sigma70_r4     1/1      84   113 ..     1    34 [.    11.3    0.024

Alignments of top-scoring domains:
Sigma70_r4_2: domain 1 of 1, from 78 to 113: score 20.5, E = 3.7e-05
                   *->leallealeeLPprqRevflLryleglsyaEIAelL<-*
                       + l eal+ LP   Re++lL y+ ++s  EIA++L   
  gi|2437946    78    NDLLSEALRNLPSNKREILLLFYFMDMSDSEIADML    113  

Sigma70_r4: domain 1 of 1, from 84 to 113: score 11.3, E = 0.024
                   *->aLdqLpereRevlvLRyGLddgeglTleEIaerL<-*
                      aL+ Lp   Re+l L y    + +++ +EIa++L   
  gi|2437946    84    ALRNLPSNKREILLLFY----FMDMSDSEIADML    113