Query sequence: gi|24379404|ref|NP_721359.1| Accession: [none] Description: hypothetical protein SMU.961 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CMD Carboxymuconolactone decarboxylase family 49.2 8.2e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CMD 1/1 42 124 .. 1 88 [] 49.2 8.2e-13 Alignments of top-scoring domains: CMD: domain 1 of 1, from 42 to 124: score 49.2, E = 8.2e-13 *->PelaealtalafgllwsRdggLdpktRELialavsaanGCeyCieLd P ++e++ +++ + ++ L+p +RE + ++++++nGC++C+ + gi|2437940 42 PTALETYRTVGEINRR--NS-LTPTEREVVQITAAVTNGCAFCV--A 83 aHtraAlkaGvteeeiaealawaaayaggpaalaAlaaaee<-* +Ht+ +k+ + ++ eal+ a ++ +p++ ++ + + gi|2437940 84 GHTAFSIKQIQMAPDLLEALRNATPIDDDPKLDTLAKFTIA 124