Query sequence: gi|24379362|ref|NP_721317.1| Accession: [none] Description: hypothetical protein SMU.915c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- GTP_cyclohydroI GTP cyclohydrolase I 184.7 2e-52 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- GTP_cyclohydroI 1/1 40 139 .. 1 105 [] 184.7 2e-52 Alignments of top-scoring domains: GTP_cyclohydroI: domain 1 of 1, from 40 to 139: score 184.7, E = 2e-52 *->emVkvtdieftslCPhhgvPDfgkvhIaYiPddkvvELksLklyves +++k++++eftslCP +g+PDf++++++YiPd+k+vE+ksLkly++s gi|2437936 40 YFIKFNCPEFTSLCPITGQPDFATIYLSYIPDKKCVESKSLKLYLFS 86 FrnrgqvQErltnqIaeaLvelLkPrgvaVvgeanHmCmvmRGgiktgve +rn+g+++E ++n+I +Lv+lL+Pr+++V+g++++ RGgi+++++ gi|2437936 87 YRNHGDFHENCINTIGKDLVDLLQPRYLEVWGKFTP-----RGGISIDPY 131 tetsaagg<-* +++ + + gi|2437936 132 YNYGRPNT 139