Query sequence: gi|24379316|ref|NP_721271.1| Accession: [none] Description: conserved hypothetical protein; putative permease [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HlyD HlyD family secretion protein 13.7 0.0023 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HlyD 1/1 98 128 .. 15 45 .. 13.7 0.0023 Alignments of top-scoring domains: HlyD: domain 1 of 1, from 98 to 128: score 13.7, E = 0.0023 *->eilvkeGdrVkaGdvLvrlDptpaeaalara<-* ++ v Gd+V aG+ Lv++D ++a+aa+++a gi|2437931 98 KVMVSAGDQVTAGQQLVQYDNSTAQAAYDQA 128