Query sequence: gi|24379303|ref|NP_721258.1| Accession: [none] Description: hypothetical protein SMU.848 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF464 Protein of unknown function (DUF464) 123.9 3.3e-34 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF464 1/1 1 109 [. 1 112 [] 123.9 3.3e-34 Alignments of top-scoring domains: DUF464: domain 1 of 1, from 1 to 109: score 123.9, E = 3.3e-34 *->MIkvviernkdgkivsleatGHAdfGeyGqDiVCAaVSallfgavNa MI++++ r g + s+e tGHA +GeyG+DiVCAaVS+l ++ vNa gi|2437930 1 MIQATFIR-RKGILESVELTGHAGSGEYGFDIVCAAVSTLSMNLVNA 46 ieelahakpvvqleksegGYLaveipnsLpednneeaqllyleamivsLk +e+la++ + +q+++ +gGY+++ + + ++ e++qll +ea++++++ gi|2437930 47 LEVLADCTVSLQMDEFDGGYMKIDLSY-ITNKSDEKVQLL-FEAFLLGIT 94 tLaesYpeyIrleve<-* +Lae+ pe+++ + gi|2437930 95 NLAENSPEFVTAKIM 109