Query sequence: gi|24379300|ref|NP_721255.1| Accession: [none] Description: hypothetical protein SMU.845 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1211 Protein of unknown function (DUF1211) 149.3 1.4e-44 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1211 1/1 2 89 .. 1 100 [] 149.3 1.4e-44 Alignments of top-scoring domains: DUF1211: domain 1 of 1, from 2 to 89: score 149.3, E = 1.4e-44 *->sKeRLeAFtDAIfAIimTILVLEilEkvPdgedvketfsggllaala KeRL+AFtDAI+AIimTILVLE+ k+P+++++++ l+ gi|2437930 2 TKERLAAFTDAILAIIMTILVLEL--KKPNPISWEN---------LW 37 allpsllaYilSFlvvgsfWfnhHrlFgFrvkkidrriiwlNlifLlvvs +l ++++aY +SF+++g +W+ +Hr+++ ++k i+++ +w++l++L++ s gi|2437930 38 QLRMNFFAYTISFFWLGAMWVLLHRNWH-DIKSISNKTVWQSLLMLFFSS 86 LlP<-* ++P gi|2437930 87 FFP 89