Query sequence: gi|24379299|ref|NP_721254.1| Accession: [none] Description: hypothetical protein SMU.844 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Acetyltransf_1 Acetyltransferase (GNAT) family 29.3 2.8e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Acetyltransf_1 1/1 49 133 .. 1 80 [] 29.3 2.8e-09 Alignments of top-scoring domains: Acetyltransf_1: domain 1 of 1, from 49 to 133: score 29.3, E = 2.8e-09 *->lvaeedgelvGfaglspidevaeieglaVdpeyRgkGiGtaLleale ++++++++ vGfa + e ++i +laV + R kG+G++ l ++ gi|2437929 49 YAYYDKERFVGFAYIIESKEQVFILFLAVNGSVRSKGYGSMILAQIR 95 eyareelGlkrieleveedNea.........AialYeklGFk<-* eya + k + l++e+ + +++++++++ + +Ye+ G++ gi|2437929 96 EYAGR----KPLILTIEPVEKDspnseqrrqRLSFYERNGYQ 133