Query sequence: gi|24379289|ref|NP_721244.1| Accession: [none] Description: hypothetical protein SMU.834 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Glycos_transf_2 Glycosyl transferase family 2 75.3 3.5e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Glycos_transf_2 1/1 6 165 .. 1 149 [] 75.3 3.5e-22 Alignments of top-scoring domains: Glycos_transf_2: domain 1 of 1, from 6 to 165: score 75.3, E = 3.5e-22 *->SviiPtYNeekyleetleSllnQttyenfEiivvDDgStDgtveiae ++ P+YNee ++++ + ++ ++ +i+v D++S+D+t e+a+ gi|2437928 6 AILLPAYNEEITIQKVISDFKRV--LPEADIYVYDNNSKDRTNELAR 50 eyakdprirvirleenlGlaaArNaGlkkAtGdydyiaflDaDdev.pdw + ++r e ++G+++ + ++ + d y + +DaDd+++ d gi|2437928 51 QA-----GAIVRFESRQGKGNVVRSMFREINAD--YYIMVDADDTYpADE 93 lekllellekngadivig.rv.in.e.n.kgr........llgk.l.l.l ++kll++l+++ ad+ ig+r++ ++ +++r+ ++ +++l + ++ + gi|2437928 94 VQKLLDPLRSGKADMTIGdRLsNGtYaEeNKRgfhgfgnnLVRLlVnHlY 143 .l.v.fli.snalyrrealekll<-* +++ ++ ++++++ + +++ k + gi|2437928 144 qGnYqDIMtGYRG-FNRLFVKNF 165