Query sequence: gi|24379287|ref|NP_721242.1| Accession: [none] Description: hypothetical protein SMU.832 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- AzlD Branched-chain amino acid transport p 13.0 0.0038 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- AzlD 1/1 275 310 .. 66 101 .] 13.0 0.0038 Alignments of top-scoring domains: AzlD: domain 1 of 1, from 275 to 310: score 13.0, E = 0.0038 *->npellAalvavalailtrnllltvlaGiavyalLrl<-* n ++ l+ ++l++l++ ++ tv+++ +vy l+++ gi|2437928 275 NIFFILLLIIIILSLLKKQFFSTVAISFIVYTLIIN 310