Query sequence: gi|24379278|ref|NP_721233.1| Accession: [none] Description: hypothetical protein SMU.823 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF59 Domain of unknown function DUF59 127.4 3.5e-35 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF59 1/1 14 89 .. 1 83 [] 127.4 3.5e-35 Alignments of top-scoring domains: DUF59: domain 1 of 1, from 14 to 89: score 127.4, E = 3.5e-35 *->lkeaileALktViDPElpvVdiVdLGlVyeLvdvdGddGEktnVkvk k++ileAL+ ViDPEl++ diV+LGl+y+ ++++ d G +++++ gi|2437927 14 IKDRILEALEMVIDPELGI-DIVNLGLIYD-IRFE-DSG---RTEID 54 mtLTtpgCPladlIaddveeAvkeslPGvedVeVel<-* mtLTt+gCPladl++d++ +A+k+ +P+v d+ V+l gi|2437927 55 MTLTTMGCPLADLLTDQIHDALKD-VPEVLDIDVKL 89