Query sequence: gi|24379256|ref|NP_721211.1| Accession: [none] Description: hypothetical protein SMU.799c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- 4HBT Thioesterase superfamily 17.7 0.0003 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- 4HBT 1/1 24 102 .. 1 74 [] 17.7 0.0003 Alignments of top-scoring domains: 4HBT: domain 1 of 1, from 24 to 102: score 17.7, E = 0.0003 *->gGvvhGGvylalaDeaagaaarslg.....vvvvelnidFlrPvrlG ++v+ + + a+++ aa +++ + ++ +++ v++++++ +l++ ++G gi|2437925 24 LNVLSTPSMIAFIENAAFLYCEEDLdvsktTVGAQITVQHLAATKIG 70 dvltvearvvrlGrtsavvevevrredgrlla<-* ++++v+ v+ ++ +++ev+ +d ++ gi|2437925 71 QTVEVKILAVEKDGHHTHFQIEVYEGDKLIGK 102