Query sequence: gi|24379252|ref|NP_721207.1| Accession: [none] Description: conserved hypothetical protein; probable esterase [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- 4HBT Thioesterase superfamily 41.2 8.1e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- 4HBT 1/1 16 101 .. 1 74 [] 41.2 8.1e-11 Alignments of top-scoring domains: 4HBT: domain 1 of 1, from 16 to 101: score 41.2, E = 8.1e-11 *->gGvvhGGvylalaDeaagaaarslg............vvvvelnidF +G+ h+ +y ++++ea+ ++++++g + ++ ++ + ++v ++ + gi|2437925 16 MGITHHSNYIRWMEEARVHFLAEIGwpydkleeagiiSPVTAVHCIY 62 lrPvrlGdvltvearvvrlGrtsavvevevrredgrlla<-* l+ ++ d++ + +v+++ ++++ ++++ +++g++++ gi|2437925 63 LATSTFADTISISVEVEKVKAARLTLSYQMINQKGKTVC 101