Query sequence: gi|24379219|ref|NP_721174.1|
Accession:      [none]
Description:    hypothetical protein SMU.757 [Streptococcus mutans UA159]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
LEA_4    Late embryogenesis abundant protein             15.0     0.0014   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
LEA_4      1/2      43    73 ..     1    31 [.     4.0      1.8
LEA_4      2/2      87   126 ..    31    74 .]    11.0    0.018

Alignments of top-scoring domains:
LEA_4: domain 1 of 2, from 43 to 73: score 4.0, E = 1.8
                   *->ekAkeaadsAkekakeakdaakdKAgeAkda<-*
                      e  ke+ ++A++k  e+kd a+   +++kd+   
  gi|2437921    43    ENPKEYHQYAADKVNEYKDVAVHSFKDYKDK    73   

LEA_4: domain 2 of 2, from 87 to 126: score 11.0, E = 0.018
                   *->aakekAeeakdkakekkageaKDtgnkakdkaeeaKdkaadakd<-*
                      ++kekA++a+  a  k   ++KD     +++ e+a  ++ da+    
  gi|2437921    87    SVKEKASQAGKFANSK-LSQVKD---HLAQTVEKAEASTNDAVI    126