Query sequence: gi|24379218|ref|NP_721173.1| Accession: [none] Description: hypothetical protein SMU.756 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF948 Bacterial protein of unknown function (DUF94 175.5 1.8e-51 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF948 1/1 4 93 .. 1 90 [] 175.5 1.8e-51 Alignments of top-scoring domains: DUF948: domain 1 of 1, from 4 to 93: score 175.5, E = 1.8e-51 *->IallIiAvAFiiLviyliitLkkvskTldevakTlqgLekqvqGitk IallI+A+AF++Lviyli L+k+s+T+de ++Tl+ L+++v+++++ gi|2437921 4 IALLIVAIAFAVLVIYLILLLRKISDTVDESRQTLKILTSDVNVTLY 50 eTteLLhKaNrLaeDvngKvatldplFdaVkDvGeSVqdlNqs<-* +T+eLL+KaN+L+eDvngKv+t+dplF+a++D++ SV+dlN++ gi|2437921 51 QTNELLAKANVLVEDVNGKVETIDPLFTAIADLSVSVSDLNRQ 93