Query sequence: gi|24379213|ref|NP_721168.1| Accession: [none] Description: conserved hypothetical protein; possible transcriptional accessory protein [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- S1 S1 RNA binding domain 67.4 4e-17 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- S1 1/1 629 702 .. 1 79 [] 67.4 4e-17 Alignments of top-scoring domains: S1: domain 1 of 1, from 629 to 702: score 67.4, E = 4e-17 *->kleeGdvveGtVtrvtklfGafVdlgengveGfvpiSeisrdkeyrv +l++G+ +eGt+ +v++ fGafVd+g + +G+++iS++s + v gi|2437921 629 DLKIGQQLEGTIRNVVD-FGAFVDIG-LHEDGLIHISQMSKN---FV 670 edpsevlkvGdevkvkvlkvDkergriiLSik<-* ++ps + vGd v v v+k+D erg++ LS+ gi|2437921 671 KHPSQIVAVGDVVTVWVSKIDIERGKVNLSLV 702