Query sequence: gi|24379200|ref|NP_721155.1| Accession: [none] Description: hypothetical protein SMU.735 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HTH_5 Bacterial regulatory protein, arsR family 13.4 0.0045 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HTH_5 1/1 34 72 .. 10 48 .] 13.4 0.0045 Alignments of top-scoring domains: HTH_5: domain 1 of 1, from 34 to 72: score 13.4, E = 0.0045 *->lLseegelcvceLaeilglSqstvShHLkkLreaGLVek<-* +L+ee++ ++ + + lglS++ +S L++L++ G++++ gi|2437920 34 MLEEEDSVTFNKIIDQLGLSKASTSTGLRFLENKGMISY 72