Query sequence: gi|24379154|ref|NP_721109.1| Accession: [none] Description: hypothetical protein SMU.681 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- A1pp Appr-1-p processing enzyme family 35.3 1.8e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- A1pp 1/1 9 61 .] 46 99 .. 35.3 1.8e-09 Alignments of top-scoring domains: A1pp: domain 1 of 1, from 9 to 61: score 35.3, E = 1.8e-09 *->pvGeAvltpgggLpakyVIHaVGPnfsgPvgeeegdelLakAYrail p+G ++t++++Lpaky++H+V P + g ++++++ lL ++Y+++l gi|2437915 9 PTGQTKITSAFNLPAKYILHTVDPIIIG-QVSQKAKDLLVSCYQSCL 54 rlaneng<-* +l+ +n+ gi|2437915 55 DLVIKNR 61