Query sequence: gi|24379055|ref|NP_721010.1| Accession: [none] Description: hypothetical protein SMU.575c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- LrgA LrgA family 74.0 1e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- LrgA 1/1 15 126 .. 1 110 [] 74.0 1e-21 Alignments of top-scoring domains: LrgA: domain 1 of 1, from 15 to 126: score 74.0, E = 1e-21 *->ivrqlaiLfgflflGewiakllg..ipiPGSIiGmllLFlLLafkvv + +q+ i +++l+++ i+ ll++ +piP +iG++l +LL++ ++ gi|2437905 15 MFIQMSIYAAILLVSQLISELLPkaLPIPTTVIGLVLMYVLLCSHII 61 kleWveqgAslLlreMlLLFVPagVGVinYfdllraqglsILvvaivSTl k eWv+ ++slL++ ++++FVP+g+++ + +++l+a+gl+++ v+++ST+ gi|2437905 62 KIEWVDSLGSLLISMIGFMFVPSGISLAANLNILKAEGLQLVAVISLSTI 111 ivllvtGllvqllrk<-* + l+++ ++ +++ gi|2437905 112 LMLVIVTYITSIILS 126