Query sequence: gi|24379037|ref|NP_720992.1| Accession: [none] Description: hypothetical protein SMU.556 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- S4 S4 domain 34.8 1.1e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- S4 1/1 185 231 .. 1 48 [] 34.8 1.1e-08 Alignments of top-scoring domains: S4: domain 1 of 1, from 185 to 231: score 34.8, E = 1.1e-08 *->mRLDkvLarlglasSRseArqlIrhGhVkVNGkvvkdpsyrvkpgDv mRLDk++a + s R++A qlI+ +Vk+N v ++s+ ++ gD gi|2437903 185 MRLDKIIAAVLKLS-RRKANQLIESEKVKLNYLVQPKVSQLIDIGDL 230 i<-* i gi|2437903 231 I 231