Query sequence: gi|24379036|ref|NP_720991.1| Accession: [none] Description: hypothetical protein SMU.555 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- YGGT YGGT family 82.2 1.4e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- YGGT 1/1 3 84 .. 1 84 [] 82.2 1.4e-22 Alignments of top-scoring domains: YGGT: domain 1 of 1, from 3 to 84: score 82.2, E = 1.4e-22 *->malllslLstlldiYsflLlirillSWvpninwynppgrflskltdP m+++ +L ++diYsflL+i++llSW+pn+ + +++g++l+ +++P gi|2437903 3 MTYVVLILARVVDIYSFLLVIYALLSWFPNA-YDTWLGKLLVDIVEP 48 yLnpFRriliPpiggiDfSPilaiivLqfLqeillrv<-* +++pFRr+ ++++g+Df i+ +++Lq L+++l + gi|2437903 49 IIKPFRRF-DFQFAGLDFKIIVILLLLQLLKRFLFLL 84