Query sequence: gi|24379035|ref|NP_720990.1| Accession: [none] Description: hypothetical protein SMU.554 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF552 Protein of unknown function (DUF552) 141.7 4.8e-40 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF552 1/1 92 171 .. 1 82 [] 141.7 4.8e-40 Alignments of top-scoring domains: DUF552: domain 1 of 1, from 92 to 171: score 141.7, E = 4.8e-40 *->ssvskIvlvePrsYedAqeIgdlLrngkaVvvNlqrmddeqAkRlvD +++++I+l+ Pr+YedA eI+dlL+ +++V++++q+m ++qA+R++D gi|2437903 92 QEKTTIALKLPRKYEDAEEIVDLLIRNECVLIDFQYMLEAQARRCLD 138 FlaGlvfaLrGsiqkVgssiFLltPelaNVdVsse<-* F++G++++L+G++qkVg s++LltP NV V++e gi|2437903 139 FIDGASKVLAGNLQKVGASMYLLTP--INVIVDAE 171