Query sequence: gi|24379023|ref|NP_720978.1| Accession: [none] Description: hypothetical protein SMU.541 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF910 Bacterial protein of unknown function (DUF91 143.6 4.6e-40 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF910 1/1 1 62 [. 1 64 [] 143.6 4.6e-40 Alignments of top-scoring domains: DUF910: domain 1 of 1, from 1 to 62: score 143.6, E = 4.6e-40 *->MKTlYDVqqLLKkfGiiiYfGdRlddiEmMeiElkeLYqygLidKed MKTlYDVq+LLK+fGi++Y+G+Rl+diEmM+iEl++LY++gLi+K+d gi|2437902 1 MKTLYDVQRLLKQFGIYVYLGKRLYDIEMMKIELERLYDNGLISKSD 47 hDYLrArLiLrrElkqe<-* YL+A+LiLrrE+++e gi|2437902 48 --YLHAELILRREHRIE 62