Query sequence: gi|24379010|ref|NP_720965.1| Accession: [none] Description: hypothetical protein SMU.528c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ABM Antibiotic biosynthesis monooxygenase 61.7 3.5e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ABM 1/1 10 73 .. 1 65 [] 61.7 3.5e-16 Alignments of top-scoring domains: ABM: domain 1 of 1, from 10 to 73: score 61.7, E = 3.5e-16 *->vkpgkeeefeealaelaeasraepGclsyellreslddpdrfvilev +k++k+eef++ l+++srae G++sy+l++ d p++fv++e+ gi|2437901 10 IKADKREEFLADTLPLIRSSRAESGNISYQLYE-AIDTPNQFVMVEE 55 WedeaAfeahlqsphfka<-* W+d+ A+++h+++p + gi|2437901 56 WQDQTAIDQHNSNPLLIQ 73