Query sequence: gi|24378932|ref|NP_720887.1| Accession: [none] Description: hypothetical protein SMU.442 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF55 Protein of unknown function DUF55 42.4 1.7e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF55 1/1 9 62 .. 1 55 [. 42.4 1.7e-11 Alignments of top-scoring domains: DUF55: domain 1 of 1, from 9 to 62: score 42.4, E = 1.7e-11 *->TnrDnwevIkeknvwGvpkrkkntinrvkpGDkliIYsaqennkdrd ++ +++ ++ +++ +v+++k+ ++ r+k+GD l++Ys++ + + gi|2437893 9 VSENHVKRGVDGGFCQVCHGKGGPLRRMKKGDYLLYYSPKIALDS-N 54 lkppkita<-* k +++ta gi|2437893 55 QKLQAFTA 62