Query sequence: gi|24378892|ref|NP_720847.1| Accession: [none] Description: hypothetical protein SMU.399 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Glyoxalase Glyoxalase/Bleomycin resistance protein/Di 10.1 0.013 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Glyoxalase 1/1 6 39 .. 1 34 [. 10.1 0.013 Alignments of top-scoring domains: Glyoxalase: domain 1 of 1, from 6 to 39: score 10.1, E = 0.013 *->ridHvapnlrVgDleksldFYtdvLGfklveetd<-* ++ + p+lr ++ e+++dFY+++LGfk++ e++ gi|2437889 6 QMEFYSPVLRINNREENIDFYQNTLGFKVLSEEN 39