Query sequence: gi|24378866|ref|NP_720821.1| Accession: [none] Description: hypothetical protein SMU.369c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1447 Protein of unknown function (DUF1447) 173.3 5.5e-49 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1447 1/1 2 76 .] 1 75 [] 173.3 5.5e-49 Alignments of top-scoring domains: DUF1447: domain 1 of 1, from 2 to 76: score 173.3, E = 5.5e-49 *->IYKVFYQEtkdevPvREtTqSLYvEaetereleGrIkvRklleddtn IYKVFYQEtkd++P+RE+T++LY+++++++el+GrI++R+l+e++ + gi|2437886 2 IYKVFYQETKDSSPRREQTKTLYLDIDAQTELDGRIQARQLVEEKIA 48 YNIEFIepLsdahLdYEKetgeFeltef<-* YNIE Ie+Lsd+hL+YEKetg+F+ltef gi|2437886 49 YNIELIELLSDKHLEYEKETGAFQLTEF 76