Query sequence: gi|24378843|ref|NP_720798.1| Accession: [none] Description: hypothetical protein SMU.345c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF24 Transcriptional regulator 30.7 1.9e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF24 1/1 17 104 .] 1 88 [. 30.7 1.9e-09 Alignments of top-scoring domains: DUF24: domain 1 of 1, from 17 to 104: score 30.7, E = 1.9e-09 *->liGgKWklLILreLldEGpkRFsELkralPgIsqKmLtqrLReLEqd +++KW l I+++ p RF++Lkr gI+ mLt++L +L q+ gi|2437884 17 ALSSKWALQIFWVISQKSPIRFNQLKREVDGITKIMLTRSLDSLIQN 63 GiinRevYpevPpkVEYSLTekGrsLePilqalckWGeeyl<-* +i e ++ P + YSLT kG++L l l WG e+l gi|2437884 64 KLIFKEDFKTWPLHTQYSLTNKGKELLNLLMSLNGWGRENL 104