Query sequence: gi|24378801|ref|NP_720756.1| Accession: [none] Description: hypothetical protein SMU.298 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CoA_binding CoA binding domain 45.0 2.3e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CoA_binding 1/1 16 108 .. 1 100 [. 45.0 2.3e-12 Alignments of top-scoring domains: CoA_binding: domain 1 of 1, from 16 to 108: score 45.0, E = 2.3e-12 *->lldkdtkVaviGignlGgalgnyhfkqmleygtkGvvfgVnPkkgGt ++ + + +a++G + + ++ +++ + g+k +++VnP+ +G+ gi|2437880 16 YVKRAKTIAIVGLSARKETAAYDVAQVLQSAGYK--IIPVNPRAVGD 60 eilGvPVynSVkeapeklketgvdvaiifVPapfAqeaidEaveAGikgI eilG Vy + ++pe+ +d++ +f+ + f ++++ +e+++ + gi|2437880 61 EILGETVYARLQDIPEH-----IDIVDVFRRSDFLADVARDFIETDADVF 105 vni<-* + + gi|2437880 106 WAQ 108