Query sequence: gi|24378797|ref|NP_720752.1| Accession: [none] Description: hypothetical protein SMU.294 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- LytTR LytTr DNA-binding domain 93.3 3.5e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- LytTR 1/1 61 158 .. 1 100 [] 93.3 3.5e-27 Alignments of top-scoring domains: LytTR: domain 1 of 1, from 61 to 158: score 93.3, E = 3.5e-27 *->grlfllplddIlyiETeaedhyvrivtadgeylvrgtLkdlekkLpp gr +l++++dI+yi e+ d+++ +++ad++y+++++L++l L gi|2437879 61 GRKYLVNFSDIYYI--ESVDKKTFVYLADEIYQTDLRLYQLLHDLQH 105 pnFlRvHRSylVNlnkIreidkdfsGrleltlkngeklpvSRrylkelke ++F+++++S+l N+n ++i++ f++r+e+tl nge + v Rryl+++ke gi|2437879 106 DGFVQISKSCLLNINVLENIRPLFNSRMEATLLNGERVIVNRRYLPDVKE 155 llk<-* +lk gi|2437879 156 ALK 158