Query sequence: gi|24378738|ref|NP_720693.1| Accession: [none] Description: hypothetical protein SMU.227c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ICMT Isoprenylcysteine carboxyl methyltransferase 43.2 9e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ICMT 1/1 71 165 .. 1 99 [] 43.2 9e-12 Alignments of top-scoring domains: ICMT: domain 1 of 1, from 71 to 165: score 43.2, E = 9e-12 *->llglLmfllgqalRkwvmvtLGeiWthrviikKlpdHrlVtsGlYry lg L+ +lg+++R++++ LG ++t v+ ++ +l+ sG+Y++ gi|2437873 71 YLGILLMILGIIFRVYAINYLGKAFTLTVQA--TDNQKLISSGPYSI 115 lRHPNYfgnviwElatlpLLcnAwytalvffplnawvLfsvRIrqEEkaL +R P Y+g i+++ +l+ + + ++++++ + + +++RIr+EE+ L gi|2437873 116 VRNPAYTG-TIISILGLAFITLN-IFNILIVFIILSIGYAIRIRTEEEVL 163 ae<-* + gi|2437873 164 EQ 165