Query sequence: gi|24378724|ref|NP_720679.1| Accession: [none] Description: hypothetical protein SMU.213c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DivIC Septum formation initiator 8.8 0.088 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DivIC 1/1 5 46 .. 1 42 [. 8.8 0.088 Alignments of top-scoring domains: DivIC: domain 1 of 1, from 5 to 46: score 8.8, E = 0.088 *->llllfqyllifgvggllayyqlnqeiaalqaelakLkaenee<-* + +++++l++f v+ ++ y+l+++ +a+q+ + + + +e+ gi|2437872 5 FGAVLLLLFWFSVYVSYQWYDLKRKYKAQQRVEKMKLQIQEQ 46