Query sequence: gi|24378564|ref|NP_720519.1| Accession: [none] Description: hypothetical protein SMU.36 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SUFU Suppressor of fused protein (SUFU) 65.8 1.9e-19 1 MinE Septum formation topological specificity fac 8.5 0.049 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- MinE 1/1 1 14 [. 1 17 [. 8.5 0.049 SUFU 1/1 27 202 .. 1 201 [. 65.8 1.9e-19 Alignments of top-scoring domains: MinE: domain 1 of 1, from 1 to 14: score 8.5, E = 0.049 *->MsLldFFksRkgknSAe<-* M+L+dFFk ++ S e gi|2437856 1 MGLFDFFKKKS---SSE 14 SUFU: domain 1 of 1, from 27 to 202: score 65.8, E = 1.9e-19 *->eKkaElKPPPGLKaliDHLisvYPdqPnPLqvttLLKYWLGGsDPLD + PG a+ + YPdqPnPL t++KY GG DPLD gi|2437856 27 KSEDTDDSAPGWEAIDAEFDRLYPDQPNPLHYGTIVKYMFGGPDPLD 73 YismYsnkfqGeverervPPHWHYvsFGLsDLHGDeRvHLkEEgvtRsGm is+Y + WH+vs+GLs+L e sG gi|2437856 74 GISVY--------DAG---DFWHFVSYGLSELYTKE-----STDSEYSGY 107 GFELtFRLAKteielkqqiEnPEKsiRaPtWPAnLLqaiaRYCFqtGnGL G ELtF+L K + E i+ LLq +aRY F+tG + gi|2437856 108 GIELTFKLKKSTND--------EEEIKN---GCGLLQYVARYIFKTGKVV 146 CFGDniPWRK..sLersadsklqsLLvAqDPqLGsiDtPtGtvDFCqivG + i +++ +++ skl L D +DtP G v+F ++G gi|2437856 147 LPEEYIYMKQtvGIDIQQKSKLTGFLTVSDNLAKPLDTPHGKVEFVTLIG 196 vteeEL<-* t+ EL gi|2437856 197 ATDAEL 202