Query sequence: gi|24378559|ref|NP_720514.1|
Accession:      [none]
Description:    hypothetical protein SMU.31 [Streptococcus mutans UA159]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
HEAT     HEAT repeat                                     17.9    0.00044   4
DUF1094  Protein of unknown function (DUF1094)            7.2      0.011   1
CHDNT    CHDNT (NUC034) domain                            9.2       0.05   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
CHDNT      1/1      15    31 ..     1    17 [.     9.2     0.05
HEAT       1/4      47    68 ..    15    36 .]     0.2       41
DUF1094    1/1      66    98 ..   111   144 .]     7.2    0.011
HEAT       2/4      80   101 ..    15    36 .]     7.4      0.4
HEAT       3/4     104   129 ..     4    29 ..     1.3       20
HEAT       4/4     139   175 ..     1    36 []     9.0     0.14

Alignments of top-scoring domains:
CHDNT: domain 1 of 1, from 15 to 31: score 9.2, E = 0.05
                   *->VeieYsEEefqsLtnyK<-*
                      +e+ + EEe + Lt yK   
  gi|2437855    15    IEHGFKEEEQRALTDYK    31   

HEAT: domain 1 of 4, from 47 to 68: score 0.2, E = 41
                   *->nDpdpeVReaAaeaLgalaevl<-*
                      +++++ VR+ A++ +g l++     
  gi|2437855    47    QSDVYQVRMYAVFLFGYLSKDK    68   

DUF1094: domain 1 of 1, from 66 to 98: score 7.2, E = 0.011
                   *->KdgeivhfieRheIEGhdiedvvkkLqaaFDeyC<-*
                      Kd+ei+ f+ R e+       v + L++aFDe+C   
  gi|2437855    66    KDKEILIFM-RDEVSKDNNWRVQEVLAKAFDEFC    98   

HEAT: domain 2 of 4, from 80 to 101: score 7.4, E = 0.4
                   *->nDpdpeVReaAaeaLgalaevl<-*
                      +D++++V+e  a+a+ ++++++   
  gi|2437855    80    KDNNWRVQEVLAKAFDEFCKKI    101  

HEAT: domain 3 of 4, from 104 to 129: score 1.3, E = 20
                   *->dellplllkllnDpdpeVReaAaeaL<-*
                      ++ lp++ ++l++++ + R+aA e L   
  gi|2437855   104    KKALPIIDEWLKSSNLHTRRAATEGL    129  

HEAT: domain 4 of 4, from 139 to 175: score 9.0, E = 0.14
                   *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-*
                      ++  +e +  + +l +D ++ VR+++ +aL ++++++   
  gi|2437855   139    KeNPNEAIRRIADLKEDVSEYVRKSVGNALRDISKKF    175