Query sequence: gi|24378540|ref|NP_720495.1| Accession: [none] Description: hypothetical protein SMU.10 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DivIC Septum formation initiator 84.0 9.7e-23 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DivIC 1/1 42 120 .. 1 82 [] 84.0 9.7e-23 Alignments of top-scoring domains: DivIC: domain 1 of 1, from 42 to 120: score 84.0, E = 9.7e-23 *->llllfqyllifgvggllayyqlnqeiaalqaelakLkaeneeLeaev ++llf+++++++v +++++++++++i++lq++ ++L a+ ++ ++ gi|2437854 42 IILLFILPAYNLVASYMNLQSKKEQIVKLQNQQKRLDAKTDAEKKFA 88 kdLknsLdpdyIeeqARseLGlvkpgEtvyrvvek<-* ++L + d+ y+e++AR +++++ +gE++y+ ++ gi|2437854 89 DRL-K--DDNYVEKYARAKYYYSIDGENIYPAPNL 120