Query sequence: gi|24378535|ref|NP_720490.1| Accession: [none] Description: hypothetical protein SMU.05 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF951 Bacterial protein of unknown function (DUF95 156.9 4.7e-44 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF951 1/1 1 63 [] 1 63 [. 156.9 4.7e-44 Alignments of top-scoring domains: DUF951: domain 1 of 1, from 1 to 63: score 156.9, E = 4.7e-44 *->efdlgdiVeMKKpHpCtiKeTGKGaNrWeIiRvGaDIkIKClnCghv +++lg++VeMKKpH+CtiK+TGK+aN+We++R+GaDIkIKC+nC+hv gi|2437853 1 MYELGSLVEMKKPHACTIKTTGKKANCWEVVRIGADIKIKCTNCDHV 47 VMiPRsdFekklKKvL<-* VM++R+dFe+k+KKvL gi|2437853 48 VMMSRHDFERKIKKVL 63